PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G061300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 263aa    MW: 28911.1 Da    PI: 9.0809
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G061300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.71.9e-33154210158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh hA++R+Rg+gGrF
  Brast02G061300.1.p 154 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHLHAMKRARGTGGRF 210
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.3E-38152213IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.916153213IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.2E-29155210IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-24156178IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860158178IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-24187210IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MTDLLLTYMD SLNSKARVEF HEMRRKEDMH ENGTIMIQFG HQVPNYDSSA SDSPQEVSGM  60
SEGSLNEQNE QSGRRDGYTN NDEGKMMSAL SLGNSETTYA QPKPDRSHPF AVAYPYADPF  120
YGGAYGSHAV MHPQIVGMVP SSRVPLPIEQ AAAEEPIYVN AKQYHAILRR RQLRAKLEAE  180
NKLVKSRKPY LHESRHLHAM KRARGTGGRF LNSKQQPEGS SGSDASTRSG NAGIPANGGM  240
FSKHDHALSS SGDLQYRVRG GA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-23154216264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754217.11e-180PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLA0A0Q3HKF31e-180A0A0Q3HKF3_BRADI; Uncharacterized protein
STRINGBRADI1G72960.11e-170(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.16e-43nuclear factor Y, subunit A6